Integrin alpha-8 Polyclonal antibody, PBS Only

• 

  WB analysis using 30714-1-AP (same clone as 30714-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30714-1-AP (Integrin alpha-8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 30714-1-AP (same clone as 30714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30714-1-AP (Integrin alpha-8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30714-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 30714-1-AP (same clone as 30714-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30714-1-AP (Integrin alpha-8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30714-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 30714-1-AP (same clone as 30714-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using Integrin alpha-8 antibody (30714-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30714-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 30714-1-AP (same clone as 30714-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using Integrin alpha-8 antibody (30714-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30714-1-PBS in a different storage buffer formulation.

Integrin alpha-8 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 30714-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

30714-1-PBS targets Integrin alpha-8 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33507

  Product name: Recombinant human Integrin alpha-8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 791-970 aa of NM_003638

  Sequence: GVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALAS

• Full Name: integrin, alpha 8
• Calculated Molecular Weight: 117 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_003638
• Gene Symbol: Integrin alpha 8
• Gene ID (NCBI): 8516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53708
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. Integrin alpha-8 is a single-pass type I membrane protein that forms a heterodimer with integrin beta-1 to serve as a receptor for RGD-containing matrix molecules (fibronectin, vitronectin, tenascin C, osteopontin, and nephronectin) (PMID: 33000355). Integrin alpha-8 beta-1 plays a critical role in epithelial-mesenchymal interactions and functions in the genesis of kidney and probably of other organs (PMID: 9054500; 19769957). The apparent molecular weight of integrin alpha-8 is larger than the calculated molecular weight of 117 kDa, possibly due to glycosylation (PMID: 7768999).