Integrin alpha-8 Polyclonal antibody, PBS Only

Integrin alpha-8 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 30714-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30714-1-PBS targets Integrin alpha-8 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag33507

Product name: Recombinant human Integrin alpha-8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 791-970 aa of NM_003638

Sequence: GVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALAS

Predict reactive species
Full Name integrin, alpha 8
Calculated Molecular Weight117 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberNM_003638
Gene Symbol Integrin alpha 8
Gene ID (NCBI) 8516
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53708
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. Integrin alpha-8 is a single-pass type I membrane protein that forms a heterodimer with integrin beta-1 to serve as a receptor for RGD-containing matrix molecules (fibronectin, vitronectin, tenascin C, osteopontin, and nephronectin) (PMID: 33000355). Integrin alpha-8 beta-1 plays a critical role in epithelial-mesenchymal interactions and functions in the genesis of kidney and probably of other organs (PMID: 9054500; 19769957). The apparent molecular weight of integrin alpha-8 is larger than the calculated molecular weight of 117 kDa, possibly due to glycosylation (PMID: 7768999).

Loading...
||
New chat Able
正在加载,请稍候...