Tested Applications
| Positive WB detected in | mouse lung tissue, rat lung tissue, rat spleen tissue |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30714-1-AP targets Integrin alpha-8 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat |
| Cited Reactivity | human, mouse, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33507 Product name: Recombinant human Integrin alpha-8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 791-970 aa of NM_003638 Sequence: GVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALAS Predict reactive species |
| Full Name | integrin, alpha 8 |
| Calculated Molecular Weight | 117 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | NM_003638 |
| Gene Symbol | Integrin alpha 8 |
| Gene ID (NCBI) | 8516 |
| RRID | AB_3086397 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P53708 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. Integrin alpha-8 is a single-pass type I membrane protein that forms a heterodimer with integrin beta-1 to serve as a receptor for RGD-containing matrix molecules (fibronectin, vitronectin, tenascin C, osteopontin, and nephronectin) (PMID: 33000355). Integrin alpha-8 beta-1 plays a critical role in epithelial-mesenchymal interactions and functions in the genesis of kidney and probably of other organs (PMID: 9054500; 19769957). The apparent molecular weight of integrin alpha-8 is larger than the calculated molecular weight of 117 kDa, possibly due to glycosylation (PMID: 7768999).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Integrin alpha-8 antibody 30714-1-AP | Download protocol |
| IHC protocol for Integrin alpha-8 antibody 30714-1-AP | Download protocol |
| WB protocol for Integrin alpha-8 antibody 30714-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Integrin alpha-8 Polyclonal antibody (Cat# 30714-1-AP) has 5 citations published in Nature Communications, Phytomedicine, Immunotargets and Therapy, Reproduction, and Animals (Basel). Research fields span nanomedicine for kidney protein delivery, cholestatic liver injury and gut-liver axis remodeling, CAR-T immunotherapy for multiple myeloma, sperm selection at the uterotubal junction, and cAMP-mediated spermatogenesis regulation in sheep.
| Species | Application | Title |
|---|---|---|
Phytomedicine Dictamnus dasycarpus Turcz. alleviates cholestatic liver injury: orchestrating tissue-divergent extracellular matrix remodeling across the gut-liver axis. | ||
Immunotargets Ther Integrin alpha8beta1 is Identified as a Potential CAR-T Target for BCMA-Resistant Relapsed Multiple Myeloma. | ||
Reproduction Postcopulatory transcriptional profiling of the murine uterotubal junction identifies potential sperm selection mediators. | ||
Animals (Basel) DIA Proteomics Reveals the Mechanism of cAMP Signaling Pathway-Mediated HPT Axis in Regulating Spermatogenesis of Hu Sheep. |
Reviews
What customers say
One verified user (Elham Javed) rated this product 5/5 stars in November 2025. They used it for immunofluorescence on human airway smooth muscle cells at a 1:100 dilution with an overnight incubation at 4°C, and reported successful results. The single review reflects a positive experience with the antibody's performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Elham (Verified Customer) (11-25-2025) | ITGA8 1:100 dilution overnight at 4C
 |
