Tested Applications
Positive WB detected in | A549 cells |
Positive IHC detected in | human pancreas cancer tissue, mouse placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 7 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
28543-1-AP targets Integrin Beta 5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species |
Full Name | integrin, beta 5 |
Calculated Molecular Weight | 88 kDa |
Observed Molecular Weight | 100 kDa |
GenBank Accession Number | BC006541 |
Gene Symbol | Integrin beta 5 |
Gene ID (NCBI) | 3693 |
RRID | AB_2881167 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P18084 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Integrin Beta 5 antibody 28543-1-AP | Download protocol |
IHC protocol for Integrin Beta 5 antibody 28543-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Aging Cell Fibronectin type III domain-containing 5 improves aging-related cardiac dysfunction in mice.
| ||
Pharmacol Res Upregulation of CSNK1A1 induced by ITGB5 confers to hepatocellular carcinoma resistance to sorafenib in vivo by disrupting the EPS15/EGFR complex
| ||
NPJ Regen Med hUC-MSCs-derived MFGE8 ameliorates locomotor dysfunction via inhibition of ITGB3/ NF-κB signaling in an NMO mouse model | ||
Int J Mol Sci Atp6v1h Deficiency Blocks Bone Loss in Simulated Microgravity Mice through the Fos-Jun-Src-Integrin Pathway | ||
Exp Brain Res MFGE8 mitigates brain injury in a rat model of SAH by maintaining vascular endothelial integrity via TIGβ5/PI3K/CXCL12 signaling. | ||
Technol Cancer Res Treat In Vivo Visualized Tracking of Tumor-Derived Extracellular Vesicles Using CRISPR-Cas9 System. |