Integrin Beta 5 Polyclonal antibody

• 

  WB analysis using 28543-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 28543-1-AP (Integrin beta-5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 28543-1-AP

  WB result of Integrin Beta 5 antibody (28543-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Integrin Beta 5 transfected A549 cells.

• 

  IHC staining of human pancreas cancer using 28543-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28543-1-AP (Integrin Beta 5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 28543-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28543-1-AP (Integrin Beta 5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse placenta using 28543-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28543-1-AP (Integrin Beta 5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse placenta using 28543-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 28543-1-AP (Integrin Beta 5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Integrin Beta 5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28543-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ITGB5, Integrin beta-5, integrin, beta 5

---

Tested Applications

• Positive WB detected in: A549 cells
• Positive IHC detected in: human pancreas cancer tissue, mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 7 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

28543-1-AP targets Integrin Beta 5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29783

  Product name: Recombinant human Integrin beta-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-126 aa of BC006541

  Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF

• Full Name: integrin, beta 5
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC006541
• Gene Symbol: Integrin beta 5
• Gene ID (NCBI): 3693
• RRID: AB_2881167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18084
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Aging Cell; Fibronectin type III domain-containing 5 improves aging-related cardiac dysfunction in mice.; Authors - Can Hu ; KD Validated
human	WB,IHC	Pharmacol Res; Upregulation of CSNK1A1 induced by ITGB5 confers to hepatocellular carcinoma resistance to sorafenib in vivo by disrupting the EPS15/EGFR complex; Authors - Li Gu ; KD Validated
mouse	IF	NPJ Regen Med; hUC-MSCs-derived MFGE8 ameliorates locomotor dysfunction via inhibition of ITGB3/ NF-κB signaling in an NMO mouse model; Authors - Huiming Xu
mouse	WB	Int J Mol Sci; Atp6v1h Deficiency Blocks Bone Loss in Simulated Microgravity Mice through the Fos-Jun-Src-Integrin Pathway; Authors - Zanyan Zhao
rat	IF	Exp Brain Res; MFGE8 mitigates brain injury in a rat model of SAH by maintaining vascular endothelial integrity via TIGβ5/PI3K/CXCL12 signaling.; Authors - Jikai Wang
mouse	WB	Technol Cancer Res Treat; In Vivo Visualized Tracking of Tumor-Derived Extracellular Vesicles Using CRISPR-Cas9 System.; Authors - Yangyang Ye