Product Information
84475-1-PBS targets Integrin beta-6 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29002 Product name: Recombinant human Integrin beta-6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 596-709 aa of BC121178 Sequence: DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP Predict reactive species |
| Full Name | integrin, beta 6 |
| Calculated Molecular Weight | 788 aa, 86 kDa |
| GenBank Accession Number | BC121178 |
| Gene Symbol | Integrin beta 6 |
| Gene ID (NCBI) | 3694 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P18564 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
