Mouse IFNAR2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of C2C12 using 87764-2-RR (same clone as 87764-2-PBS)

  C2C12 cells were subjected to SDS PAGE followed by western blot with 87764-2-RR (Interferon alpha/beta receptor 2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87764-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP03193-1

  The mean IFNAR2 concentration was determined to be 44.7 ng/mL in mouse liver extract based on a 8.4 mg/mL extract load, 13.1 ng/mL in mouse brain extract based on a 6.3 mg/mL extract load and 6.2 ng/mL in mouse colon extract based on a 4.9 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03193-1

  Sandwich ELISA standard curve of MP03193-1, Mouse IFNAR2 Recombinant Matched Antibody Pair - PBS only. 87764-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg6269. 87764-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  IF Staining of RAW 264.7 using 87764-2-RR (same clone as 87764-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using Interferon alpha/beta receptor 2 antibody (87764-2-RR, Clone: 252155C12 ) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87764-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP03193-1

  The mean IFNAR2 concentration was determined to be 56.7 ng/mL in mouse liver tissue extract based on a 8.4 mg/mL extract load, 11.3 ng/mL in mouse brain tissue extract based on a 6.3 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP03193-1

  Cytometric bead array standard curve of MP03193-1, MOUSE IFNAR2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87764-2-PBS. Detection antibody: 87764-1-PBS. Standard: Eg6269. Range: 0.156-10 ng/mL.

IFNAR2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87764-2-PBS

Clone No.252155C12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

IFN-alpha/beta receptor 2, IFN-R-2, Interferon alpha/beta receptor 2, Type I interferon receptor 2

---

Product Information

87764-2-PBS targets IFNAR2 as part of a matched antibody pair:

MP03193-1: 87764-2-PBS capture and 87764-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6269

  Product name: Recombinant mouse Interferon alpha/beta receptor 2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-242 aa of NM_010509

  Sequence: SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA

• Full Name: interferon (alpha and beta) receptor 2
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 55, 110 kDa
• GenBank Accession Number: NM_010509
• Gene Symbol: Ifnar2
• Gene ID (NCBI): 15976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O35664-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interferon alpha/beta receptor 2 (IFNAR2) is a type I membrane protein that associates with IFNAR1 to form the receptor for type I interferons. Binding and activation of the receptor stimulate Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2, and then increase transcription of the IFN-induced genes whose products exert antiviral, immunomodulatory, and antiproliferative effects.