JIP3 Polyclonal antibody, PBS Only

• 

  WB analysis using 25212-1-AP (same clone as 25212-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25212-1-AP (JIP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25212-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 25212-1-AP (same clone as 25212-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25212-1-AP (JIP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25212-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 25212-1-AP (same clone as 25212-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25212-1-AP (JIP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25212-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

JIP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25212-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

MAPK8IP3, C-Jun-amino-terminal kinase-interacting protein 3, JIP 3, JIP-3, JNK interacting protein 3

---

Product Information

25212-1-PBS targets JIP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19561

  Product name: Recombinant human JIP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-248 aa of BC137123

  Sequence: MIQTYVEHIERSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQLQSSSSYQ

• Full Name: mitogen-activated protein kinase 8 interacting protein 3
• Calculated Molecular Weight: 1336 aa, 147 kDa
• Observed Molecular Weight: 147 kDa
• GenBank Accession Number: BC137123
• Gene Symbol: JIP3
• Gene ID (NCBI): 23162
• RRID: AB_2879962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

JIP3, also known as JNK-interacting protein 3 or JSAP1 (JNK/SAPK-associated protein 1), is a crucial scaffold protein primarily involved in organizing and regulating signal transduction pathways, especially the c-Jun N-terminal kinase (JNK) pathway.