JMJD4 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 21572-1-AP (same clone as 21572-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21572-1-AP (JMJD4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21572-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21572-1-AP (same clone as 21572-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21572-1-AP (JMJD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21572-1-PBS in a different storage buffer formulation.

JMJD4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21572-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21572-1-PBS targets JMJD4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16099

  Product name: Recombinant human JMJD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 114-463 aa of BC109272

  Sequence: RRRWVTPAGRPDFDHLLRTYGDVVVPVANCGVQEYNSNPKEHMTLRDYITYWKEYIQAGYSSPRGCLYLKDWHLCRDFPVEDVFTLPVYFSSDWLNEFWDALDVDDYRFVYAGPAGSWSPFHADIFRSFSWSVNVCGRKKWLLFPPGQEEALRDRHGNLPYDVTSPALCDTHLHPRNQLAGPPLEITQEAGEMVFVPSGWHHQVHNLDDTISINHNWVNGFNLANMWRLLQQELCAVQEEVSEWRDSMPDWHHHCQVIMRSCSGINFEEFYHFLKVIAEKRLLVLREAAAEDGAGLGFEQAAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP

• Full Name: jumonji domain containing 4
• Calculated Molecular Weight: 463 aa, 52 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC109272
• Gene Symbol: JMJD4
• Gene ID (NCBI): 65094
• RRID: AB_2878886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H9V9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

JMJD4 (JmjC domain-containing protein 4, Jumonji domain-containing protein 4) is a member of the JmjC domain-containing proteins. Several JmjC domain-containing proteins have been reported to play a crucial role in the control of gene expression by acting as protein hydroxylases or histone demethylases (PMID: 16983801; 21300889). The function of JMJD4 protein remains unknown. The gene of JMJD4 maps to chromosome 1q42.13.