Tested Applications
| Positive WB detected in | HT-1080 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human lymphoma tissue, human breast cancer tissue, human ovary tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10486-1-AP targets JUNB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0752 Product name: Recombinant human JUNB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004250 Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA Predict reactive species |
| Full Name | jun B proto-oncogene |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 38 kDa, 42 kDa |
| GenBank Accession Number | BC004250 |
| Gene Symbol | JUNB |
| Gene ID (NCBI) | 3726 |
| RRID | AB_2129996 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
JunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for JUNB antibody 10486-1-AP | Download protocol |
| IHC protocol for JUNB antibody 10486-1-AP | Download protocol |
| IP protocol for JUNB antibody 10486-1-AP | Download protocol |
| WB protocol for JUNB antibody 10486-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Able is busy answering your previous question. Please try again later.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther MDIG-mediated H3K9me3 demethylation upregulates Myc by activating OTX2 and facilitates liver regeneration | ||
Cell Metab Compartmentalized branched-chain amino acid metabolism orchestrates colorectal cancer dissemination via an UMP-vimentin axis. | ||
Nat Immunol The co-inhibitory receptor TIGIT promotes tissue-protective functions in T cells. | ||
Nat Commun High resolution profiling of cell cycle-dependent protein and phosphorylation abundance changes in non-transformed cells | ||
Pharmacol Res Cyclo-(Phe-Tyr) as a novel cyclic dipeptide compound alleviates ischemic/reperfusion brain injury via JUNB/JNK/NF-κB and SOX5/PI3K/AKT pathways. | ||
Reviews
What customers say
The single review for this product is highly positive, with a 5-star rating. The reviewer described it as an "excellent antibody" and used it at a 1:500 dilution for Western Blot on HTR cells, indicating strong performance in their application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vignesh (Verified Customer) (11-05-2025) | Excellent antibody
|
