CoraLite® Plus 488-conjugated JUNB Polyclonal antibody

• 

  IF Staining of HeLa using CL488-10486

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 JUNB antibody (CL488-10486) at dilution of 1:100.

• 

  FC experiment of MCF-7 using CL488-10486

  1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug Coralite® Plus 488 JUNB Polyclonal Antibody (CL488-10486)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

JUNB Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10486

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

AP 1, AP-1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10486 targets JUNB in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0752

  Product name: Recombinant human JUNB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004250

  Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA

• Full Name: jun B proto-oncogene
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 38 kDa, 42 kDa
• GenBank Accession Number: BC004250
• Gene Symbol: JUNB
• Gene ID (NCBI): 3726
• RRID: AB_3672444
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17275
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

JunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context