Tested Applications
Positive WB detected in | A431 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IP | See 2 publications below |
Product Information
28770-1-AP targets KAT2B/PCAF in WB, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30238 Product name: Recombinant human KAT2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 366-424 aa of BC060823 Sequence: DQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEAN Predict reactive species |
Full Name | K(lysine) acetyltransferase 2B |
Calculated Molecular Weight | 93 kDa |
Observed Molecular Weight | 95-110 kDa |
GenBank Accession Number | BC060823 |
Gene Symbol | PCAF/KAT2B |
Gene ID (NCBI) | 8850 |
RRID | AB_2918200 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92831 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KAT2B/PCAF antibody 28770-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Exp Clin Cancer Res The histone lysine acetyltransferase KAT2B inhibits cholangiocarcinoma growth: evidence for interaction with SP1 to regulate NF2-YAP signaling | ||
Cancer Cell Tumor cells impair immunological synapse formation via central nervous system-enriched metabolite | ||
J Proteome Res Integrative Analysis of Lactylome and Proteome of Hypertrophic Scar To Identify Pathways or Proteins Associated with Disease Development | ||
Mol Med Celastrol promotes DNA damage and apoptosis in uterine corpus endometrial carcinoma via promotion of KAT2B-mediated RBPJ acetylation and repression of MCM4 transcription | ||
EMBO J SLC25A1 and ACLY maintain cytosolic acetyl-CoA and regulate ferroptosis susceptibility via FSP1 acetylation | ||
J Cell Mol Med SIRT2-mediated deacetylation of ACLY promotes the progression of oesophageal squamous cell carcinoma |