Tested Applications
| Positive WB detected in | A431 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IP | See 2 publications below |
Product Information
28770-1-AP targets KAT2B/PCAF in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30238 Product name: Recombinant human KAT2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 366-424 aa of BC060823 Sequence: DQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEAN Predict reactive species |
| Full Name | K(lysine) acetyltransferase 2B |
| Calculated Molecular Weight | 93 kDa |
| Observed Molecular Weight | 95-110 kDa |
| GenBank Accession Number | BC060823 |
| Gene Symbol | PCAF/KAT2B |
| Gene ID (NCBI) | 8850 |
| RRID | AB_2918200 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92831 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KAT2B/PCAF antibody 28770-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Exp Clin Cancer Res The histone lysine acetyltransferase KAT2B inhibits cholangiocarcinoma growth: evidence for interaction with SP1 to regulate NF2-YAP signaling | ||
Cancer Cell Tumor cells impair immunological synapse formation via central nervous system-enriched metabolite | ||
J Proteome Res Integrative Analysis of Lactylome and Proteome of Hypertrophic Scar To Identify Pathways or Proteins Associated with Disease Development | ||
Mol Med Celastrol promotes DNA damage and apoptosis in uterine corpus endometrial carcinoma via promotion of KAT2B-mediated RBPJ acetylation and repression of MCM4 transcription | ||
EMBO J SLC25A1 and ACLY maintain cytosolic acetyl-CoA and regulate ferroptosis susceptibility via FSP1 acetylation | ||
J Cell Mol Med SIRT2-mediated deacetylation of ACLY promotes the progression of oesophageal squamous cell carcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S R CHAITANYA (Verified Customer) (10-24-2025) | The antibody works well, yielding a predicted band size of approximately 100 kDa. However, non-specific bands also appear below 75kDa.
![]() |


