Tested Applications
| Positive WB detected in | Saos-2 cells, TT cells, U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31743-1-AP targets KBTBD6 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36046 Product name: Recombinant human KBTBD6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 625-674 aa of BC000560 Sequence: PGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ Predict reactive species |
| Full Name | kelch repeat and BTB (POZ) domain containing 6 |
| Observed Molecular Weight | 76 kDa |
| GenBank Accession Number | BC000560 |
| Gene Symbol | KBTBD6 |
| Gene ID (NCBI) | 89890 |
| RRID | AB_3670103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q86V97 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KBTBD6 (Kelch repeat and BTB domain-containing protein 6) is involved in proteasome-mediated ubiquitin-dependent protein catabolic process; protein K48-linked ubiquitination; and Rac protein signal transduction regulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KBTBD6 antibody 31743-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

