KCNE1 Polyclonal antibody, PBS Only

• 

  WB analysis using 15150-1-AP (same clone as 15150-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15150-1-AP (KCNE1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15150-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart tissue using 15150-1-AP (same clone as 15150-1-PBS)

  IF result of anti-KCNE1 (15150-1-AP) in frozen mouse heart section by Dr Nicola Smart. This data was developed using the same antibody clone with 15150-1-PBS in a different storage buffer formulation.

KCNE1 Polyclonal Antibody for WB, IF, Indirect ELISA

Cat No. 15150-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, Indirect ELISA

Synonyms

IKs producing slow voltage-gated potassium channel subunit beta Mink, ISK, JLNS, JLNS2, LQT2/5

---

Product Information

15150-1-PBS targets KCNE1 in WB, IF, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3495

  Product name: Recombinant human KCNE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC036452

  Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS

• Full Name: potassium voltage-gated channel, Isk-related family, member 1
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC036452
• Gene Symbol: KCNE1
• Gene ID (NCBI): 3753
• RRID: AB_2131977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15382
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Potassium voltage-gated channel subfamily E member 1 (KCNE1) is an ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex (PMID: 19219384; 20533308; 9230439). The KCNQ1 + KCNE1 potassium channel complex generates the slow delayed rectifier current (IKs), which is critical for cardiac repolarization (PMID: 41034624).