Tested Applications
| Positive WB detected in | mouse kidney tissue |
| Positive IF detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF) | IF : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15150-1-AP targets KCNE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3495 Product name: Recombinant human KCNE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC036452 Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS Predict reactive species |
| Full Name | potassium voltage-gated channel, Isk-related family, member 1 |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC036452 |
| Gene Symbol | KCNE1 |
| Gene ID (NCBI) | 3753 |
| RRID | AB_2131977 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15382 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Potassium voltage-gated channel subfamily E member 1 (KCNE1) is an ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex (PMID: 19219384; 20533308; 9230439). The KCNQ1 + KCNE1 potassium channel complex generates the slow delayed rectifier current (IKs), which is critical for cardiac repolarization (PMID: 41034624).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KCNE1 antibody 15150-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KCNE1 Polyclonal antibody (Cat# 15150-1-AP) has 2 total citations. These publications appear in British Journal of Pharmacology and Cardiovascular Therapeutics. The research fields are cardiac electrophysiology and cardiovascular disease, specifically addressing aldosterone's effect on delayed rectifier potassium current in guinea pig cardiomyocytes and LCZ696 therapy's impact on ventricular tachyarrhythmia in a rat heart failure model. Both citations used the antibody for Western blot applications.
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Aldosterone downregulates slowly activated delayed rectifier potassium current in adult guinea pig cardiomyocytes. | ||
Cardiovasc Ther LCZ696 Therapy Reduces Ventricular Tachyarrhythmia Inducibility in a Myocardial Infarction-Induced Heart Failure Rat Model. |
