Tested Applications
| Positive WB detected in | mouse kidney tissue |
| Positive IF detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF) | IF : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
15150-1-AP targets KCNE1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3495 Product name: Recombinant human KCNE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC036452 Sequence: MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS Predict reactive species |
| Full Name | potassium voltage-gated channel, Isk-related family, member 1 |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC036452 |
| Gene Symbol | KCNE1 |
| Gene ID (NCBI) | 3753 |
| RRID | AB_2131977 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15382 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Potassium voltage-gated channel subfamily E member 1 (KCNE1) is an ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE1 beta subunit modulates the gating kinetics and enhances stability of the channel complex (PMID: 19219384; 20533308; 9230439). The KCNQ1 + KCNE1 potassium channel complex generates the slow delayed rectifier current (IKs), which is critical for cardiac repolarization (PMID: 41034624).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KCNE1 antibody 15150-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Aldosterone downregulates slowly activated delayed rectifier potassium current in adult guinea pig cardiomyocytes. | ||
Cardiovasc Ther LCZ696 Therapy Reduces Ventricular Tachyarrhythmia Inducibility in a Myocardial Infarction-Induced Heart Failure Rat Model. |



