KCNH2 Polyclonal antibody

• 

KCNH2 Polyclonal Antibody for ELISA

Cat No. 19903-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Eag homolog, Eag related protein 1, ERG, ERG 1, ERG1, H ERG, HERG, hERG 1, HERG1, KCNH2, Kv11.1, LQT2, SQT1

---

Product Information

19903-1-AP targets KCNH2 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13875

  Product name: Recombinant human KCNH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-681 aa of BC001914

  Sequence: AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVV

• Full Name: potassium voltage-gated channel, subfamily H (eag-related), member 2
• Calculated Molecular Weight: 1159 aa, 127 kDa
• GenBank Accession Number: BC001914
• Gene Symbol: KCNH2
• Gene ID (NCBI): 3757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12809
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.