Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
21647-1-AP targets GIRK2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16344 Product name: Recombinant human KCNJ6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 351-423 aa of BC101547 Sequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV Predict reactive species |
Full Name | potassium inwardly-rectifying channel, subfamily J, member 6 |
Calculated Molecular Weight | 423 aa, 48 kDa |
Observed Molecular Weight | 45-48 kDa |
GenBank Accession Number | BC101547 |
Gene Symbol | GIRK2 |
Gene ID (NCBI) | 3763 |
RRID | AB_10794447 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48051 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GIRK2 (also known as Kir3.2), encoded by KCNJ6 gene, is a member of the G protein-coupled inwardly-rectifying potassium channel (GIRK, Kir3) family of inward rectifier potassium channels. GIRK channels are activated following stimulation of G protein-coupled receptors (PMID: 26422984). They play important roles in regulating cellular excitabilities in the heart and brain (PMID: 31043612). Mutations in KCNJ6 gene are associated with Keppen-Lubinsky Syndrome (PMID: 25620207).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GIRK2 antibody 21647-1-AP | Download protocol |
IHC protocol for GIRK2 antibody 21647-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Ther Nucleic Acids Modulation of miR-181 influences dopaminergic neuronal degeneration in a mouse model of Parkinson's disease. | ||
FASEB J Electro-acupuncture alleviates adolescent cocaine exposure-enhanced anxiety-like behaviors in adult mice by attenuating the activities of PV interneurons in PrL. | ||
Front Neurosci Deregulation of mTORC1-TFEB axis in human iPSC model of GBA1-associated Parkinson's disease | ||
Prog Neurobiol TRPM2 as a conserved gatekeeper determines the vulnerability of DA neurons by mediating ROS sensing and calcium dyshomeostasis |