Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, THP-1 cells, U-87 MG cells, PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29988-1-AP targets KCNS1 in WB, ELISA applications and shows reactivity with Human, rat samples.
| Tested Reactivity | Human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31380 Product name: Recombinant human KCNS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-526 aa of BC075033 Sequence: VTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQEFEDLLSSVDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY Predict reactive species |
| Full Name | potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1 |
| Calculated Molecular Weight | 526 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC075033 |
| Gene Symbol | KCNS1 |
| Gene ID (NCBI) | 3787 |
| RRID | AB_3086205 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KK3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KCNS1 antibody 29988-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

