KCTD15 Polyclonal antibody

• 

  WB analysis using 20128-1-AP

  Mouse brain tissues were subjected to SDS PAGE followed by western blot with 20128-1-AP (KCTD15 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20128-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 20128-1-AP (KCTD15 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 20128-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20128-1-AP (KCTD15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 20128-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 20128-1-AP (KCTD15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of C6 using 20128-1-AP

  IP result of anti-KCTD15 (IP:20128-1-AP, 4ug; Detection:20128-1-AP 1:500) with C6 cells lysate 1960 ug.

• 

  IHC staining of mouse spleen using 20128-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 20128-1-AP (KCTD15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 20128-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 20128-1-AP (KCTD15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

KCTD15 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 20128-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

BTB/POZ domain-containing protein KCTD15, Potassium channel tetramerization domain-containing protein 15

---

Tested Applications

• Positive WB detected in: mouse brain tissue, C6 cells, HEK-293 cells, mouse lung tissue
• Positive IP detected in: C6 cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

20128-1-AP targets KCTD15 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13962

  Product name: Recombinant human KCTD15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-234 aa of BC001185

  Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL

• Full Name: potassium channel tetramerisation domain containing 15
• Calculated Molecular Weight: 283 aa, 32 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC001185
• Gene Symbol: KCTD15
• Gene ID (NCBI): 79047
• RRID: AB_10646430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96SI1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCTD15 is a member of the KCTD family of proteins, which are involved in various biological processes. KCTD15 plays a role in embryonic development by regulating the neural crest domain. It inhibits neural crest induction by repressing the Wnt/β-catenin signaling pathway. KCTD15 is involved in the NF-κB signaling pathway, which is crucial for immune responses and inflammation. Its deregulation can influence the activation of the IKK-β enzyme complex, triggering the NF-κB pathway. KCTD15's expression levels in peripheral blood cells and leukemia cells suggest its potential as a biomarker for diagnosing and monitoring acute leukemias. Its distinct expression profile in different types of white blood cells highlights its importance in both physiological and pathological processes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogenesis; KCTD15 inhibits the Hedgehog pathway in Medulloblastoma cells by increasing protein levels of the oncosuppressor KCASH2.; Authors - Eleonora Spiombi ; KD Validated
		Proc Natl Acad Sci U S A; KCTD1 regulation of Adenylyl cyclase type 5 adjusts striatal cAMP signaling; Authors - Yini Liao