KCTD16 Polyclonal antibody, PBS Only

• 

  WB analysis using 25437-1-AP (same clone as 25437-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25437-1-AP (KCTD16 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25437-1-PBS in a different storage buffer formulation.

KCTD16 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25437-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25437-1-PBS targets KCTD16 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22064

  Product name: Recombinant human KCTD16 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 318-396 aa of BC113435

  Sequence: QSEASSPQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELE

• Full Name: potassium channel tetramerisation domain containing 16
• Calculated Molecular Weight: 428 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC113435
• Gene Symbol: KCTD16
• Gene ID (NCBI): 57528
• RRID: AB_2880079
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68DU8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.