Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25437-1-AP targets KCTD16 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22064 Product name: Recombinant human KCTD16 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 318-396 aa of BC113435 Sequence: QSEASSPQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELE Predict reactive species |
Full Name | potassium channel tetramerisation domain containing 16 |
Calculated Molecular Weight | 428 aa, 49 kDa |
Observed Molecular Weight | 49 kDa |
GenBank Accession Number | BC113435 |
Gene Symbol | KCTD16 |
Gene ID (NCBI) | 57528 |
RRID | AB_2880079 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q68DU8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KCTD16 antibody 25437-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |