KCTD16 Polyclonal antibody

• 

  WB analysis using 25437-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25437-1-AP (KCTD16 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

KCTD16 Polyclonal Antibody for WB, ELISA

Cat No. 25437-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KCTD16, KIAA1317

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25437-1-AP targets KCTD16 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22064

  Product name: Recombinant human KCTD16 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 318-396 aa of BC113435

  Sequence: QSEASSPQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELE

• Full Name: potassium channel tetramerisation domain containing 16
• Calculated Molecular Weight: 428 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC113435
• Gene Symbol: KCTD16
• Gene ID (NCBI): 57528
• RRID: AB_2880079
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68DU8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.