KChIP1 Polyclonal antibody, PBS Only

• 

  WB analysis of human cerebellum using 14212-1-AP (same clone as 14212-1-PBS)

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 14212-1-AP (KChIP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 14212-1-AP (same clone as 14212-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 14212-1-AP (KChIP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

• 

  IP experiment of fetal human brain using 14212-1-AP (same clone as 14212-1-PBS)

  IP result of anti-KChIP1 (IP:14212-1-AP, 4ug; Detection:14212-1-AP 1:300) with fetal human brain tissue lysate 3500 ug. This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14212-1-AP (same clone as 14212-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14212-1-AP (KChIP1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14212-1-AP (same clone as 14212-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14212-1-AP (KChIP1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 14212-1-AP (same clone as 14212-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug KChIP1 Polyclonal antibody (14212-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 14212-1-PBS in a different storage buffer formulation.

KChIP1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, Indirect ELISA

Cat No. 14212-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), IP, Indirect ELISA

Synonyms

KCNIP1, A-type potassium channel modulatory protein 1, Kv channel-interacting protein 1, Potassium channel-interacting protein 1, VABP

---

Product Information

14212-1-PBS targets KChIP1 in WB, IHC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5432

  Product name: Recombinant human KCNIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC050375

  Sequence: MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

• Full Name: Kv channel interacting protein 1
• Calculated Molecular Weight: 227 aa, 27 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC050375
• Gene Symbol: KCNIP1
• Gene ID (NCBI): 30820
• RRID: AB_2265412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZI2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human K(v) channel interacting protein 1 (KCHIP1) is a new member of the neural calcium binding protein superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. KChIP1 is a neuronal calcium sensor protein that is predominantly expressed at GABAergic synapses and it has been related with modulation of K(+) channels, GABAergic transmission and cell death.