KDELR3 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 27632-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27632-1-AP (KDELR3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

KDELR3 Polyclonal Antibody for WB, ELISA

Cat No. 27632-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

ERD23, KDEL receptor 3, KDEL endoplasmic reticulum protein retention receptor 3, ER lumen protein-retaining receptor 3

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

27632-1-AP targets KDELR3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26496

  Product name: Recombinant human KDELR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-115 aa of BC001277

  Sequence: FISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTL

• Full Name: KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3
• Calculated Molecular Weight: 214 aa, 25 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC001277
• Gene Symbol: KDELR3
• Gene ID (NCBI): 11015
• RRID: AB_2880932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Genet; Transcriptomic Analysis of Glycolysis-Related Genes Reveals an Independent Signature of Bladder Carcinoma.; Authors - Zezhong Mou
human,zebrafish	WB	Nat Commun; Exome-wide association study identifies KDELR3 mutations in extreme myopia; Authors - Jian Yuan
human	WB	Haematologica; Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis.; Authors - Nunziata Maio