Tested Applications
Positive WB detected in | NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
27632-1-AP targets KDELR3 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, zebrafish |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26496 Product name: Recombinant human KDELR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 55-115 aa of BC001277 Sequence: FISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTL Predict reactive species |
Full Name | KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 |
Calculated Molecular Weight | 214 aa, 25 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC001277 |
Gene Symbol | KDELR3 |
Gene ID (NCBI) | 11015 |
RRID | AB_2880932 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43731 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KDELR3 antibody 27632-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Genet Transcriptomic Analysis of Glycolysis-Related Genes Reveals an Independent Signature of Bladder Carcinoma. | ||
Haematologica Dimeric ferrochelatase bridges ABCB7 and ABCB10 homodimers in an architecturally defined molecular complex required for heme biosynthesis. |