KDELR3 Polyclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 27632-1-AP (same clone as 27632-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27632-1-AP (KDELR3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27632-1-PBS in a different storage buffer formulation.

KDELR3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27632-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

ERD23, KDEL receptor 3, KDEL endoplasmic reticulum protein retention receptor 3, ER lumen protein-retaining receptor 3

---

Product Information

27632-1-PBS targets KDELR3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26496

  Product name: Recombinant human KDELR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-115 aa of BC001277

  Sequence: FISIYNTVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTL

• Full Name: KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3
• Calculated Molecular Weight: 214 aa, 25 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC001277
• Gene Symbol: KDELR3
• Gene ID (NCBI): 11015
• RRID: AB_2880932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43731
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.