Ki-67 Monoclonal antibody

• 

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 66555-1-Ig

Clone No.4G8A6

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (2)

Applications

IHC, ELISA

Synonyms

Antigen KI 67, Ki 67, KI67, KIA, MKI67

---

Published Applications

• IHC: See 2 publications below

Product Information

66555-1-Ig targets KI67 in IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26266

  Product name: Recombinant human KI67 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1201-1300 aa of NM_002417

  Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

• Full Name: antigen identified by monoclonal antibody Ki-67
• Calculated Molecular Weight: 359 kDa
• GenBank Accession Number: NM_002417
• Gene Symbol: KI67
• Gene ID (NCBI): 4288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46013
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Cancer Res Clin Oncol; NOD2 inhibits the proliferation of esophageal adenocarcinoma cells through autophagy; Authors - Xiaozhi Li
rat	IHC	Light Sci Appl; Dual-step photo-induced self-assembled hydrogel for endogenous oral mucosal wound healing; Authors - Shaojun Fang