PAF15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAF15 Polyclonal antibody (20537-1-AP)

PAF15 Polyclonal Antibody for WB, ELISA

Cat No. 20537-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA0101, HCV NS5A-transactivated protein 9, Hepatitis C virus NS5A-transactivated protein 9, L5, NS5ATP9

• 

  WB analysis using 20537-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20537-1-AP (PAF15 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells, MG-63 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20537-1-AP targets PAF15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14522

  Product name: Recombinant human KIAA0101 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-111 aa of BC005832

  Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

• Full Name: KIAA0101
• Calculated Molecular Weight: 111 aa, 12 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC005832
• Gene Symbol: KIAA0101
• Gene ID (NCBI): 9768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAF15, also known as PCLAF/KIAA0101, located at 15q14, is a small nuclear protein that binds to PCNA. Its expression fluctuated with the cell cycle, with high expression in S/G2 phase and degradation in G1 phase. Anchoring replication fork by PIP motif, specifically stabilizing the synthesis of lag chain, and regulating S-phase checkpoint; Participate in cross-injury repair when DNA is damaged. The gene is abnormally overexpressed in various solid tumors, which drives tumor progress by disturbing genome stability, promoting proliferation and antagonizing apoptosis. The overexpression indicates poor prognosis, and it is a tumor prognosis marker and potential therapeutic target. There are reports of 15kDa bands and 25 kDa bands with ubiquitination modification (PMID: 41606318).