Product Information
20537-1-AP targets PAF15 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14522 Product name: Recombinant human KIAA0101 protein Source: e coli.-derived, PKG Tag: GST Domain: 1-111 aa of BC005832 Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE Predict reactive species |
| Full Name | KIAA0101 |
| Calculated Molecular Weight | 111 aa, 12 kDa |
| GenBank Accession Number | BC005832 |
| Gene Symbol | KIAA0101 |
| Gene ID (NCBI) | 9768 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
