Use Able AI chat for product recommendations

ATG13 Monoclonal antibody

ATG13 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66708-1-Ig
Clone No. 1C3A7
Publications (4)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

KIAA0652, 1C3A7, Autophagy related protein 13, Autophagy-related protein 13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ATG13 in ?

Tested Applications

Positive WB detected inHEK-293 cells, BGC-823 cells, NIH/3T3 cells, pig brain tissue, rat brain tissue, mouse brain tissue, HeLa cells, Jurkat cells
Positive IHC detected inmouse testis tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66708-1-Ig targets ATG13 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12968

Product name: Recombinant human KIAA0652 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 131-481 aa of BC001331

Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ*

Predict reactive species
Full Name KIAA0652
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC001331
Gene Symbol ATG13
Gene ID (NCBI) 9776
RRIDAB_2882060
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75143
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405)

Protocols

Product Specific Protocols
FC protocol for ATG13 antibody 66708-1-IgDownload protocol
IF protocol for ATG13 antibody 66708-1-IgDownload protocol
IHC protocol for ATG13 antibody 66708-1-IgDownload protocol
WB protocol for ATG13 antibody 66708-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ATG13 Monoclonal antibody (1C3A7), catalog number 66708-1-Ig, has 4 total citations. These appear in Autophagy, Cell Reports, Biochemical Journal, and Cancer Chemotherapy and Pharmacology. The cited research spans autophagy mechanisms, clear cell renal cell carcinoma progression, neonatal autophagy and survival, obesity-associated nephropathy, and osteosarcoma antitumor therapy via the AMPK/ULK1 pathway. All cited applications were Western blot in human or mouse samples.

SpeciesApplicationTitle

Autophagy

AARS2-mediated lactylation of ULK1 promotes autophagy-dependent progression of clear cell renal cell carcinoma.

Authors - Xiangbo Zeng
mouseWB

Cell Rep

Destabilization of TP53 by USP10 is essential for neonatal autophagy and survival

Authors - Hongchang Li
mouseWB

Biochem J

Dapagliflozin regulates autophagy in nephropathy associated with non-diabetic obesity via elevated plasma β-hydroxybutyrate levels.

Authors - Yan Kong
humanWB

Cancer Chemother Pharmacol

Avermectin B1 mediates antitumor activity and induces autophagy in osteosarcoma through the AMPK/ULK1 signaling pathway

Authors - Xiang Fei
Loading...
||
New chat

Able™

正在加载,请稍候...