Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
20945-1-AP targets KIAA1984 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15053 Product name: Recombinant human KIAA1984 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 426-495 aa of BC007542 Sequence: QREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENREEDMI Predict reactive species |
Full Name | KIAA1984 |
Calculated Molecular Weight | 534 aa, 63 kDa |
Observed Molecular Weight | 45-55 kDa |
GenBank Accession Number | BC007542 |
Gene Symbol | KIAA1984 |
Gene ID (NCBI) | 84960 |
RRID | AB_2878772 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5T5S1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KIAA1984 antibody 20945-1-AP | Download protocol |
IF protocol for KIAA1984 antibody 20945-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |