KIF15 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82903-1-RR (same clone as 82903-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82903-1-RR (KIF15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82903-1-RR (same clone as 82903-1-PBS)

  WB result of KIF15 antibody (82903-1-RR; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIF15 transfected HeLa cells. This data was developed using the same antibody clone with 82903-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 82903-1-RR (same clone as 82903-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 82903-1-RR (KIF15 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82903-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82903-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82903-1-RR against Human KIF15 were performed. The affinity constant is 75.8 pM.

• Featured Product
• KD/KO Validated

KIF15 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82903-1-PBS

Clone No.230049F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

230049F1, hKLP2, Kinesin-like protein 2, Kinesin-like protein 7, Kinesin-like protein KIF15

---

Product Information

82903-1-PBS targets KIF15 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33897

  Product name: Recombinant human KIF15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 950-1050 aa of NM_020242

  Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR

• Full Name: kinesin family member 15
• Calculated Molecular Weight: 160 kDa
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: NM_020242
• Gene Symbol: KIF15
• Gene ID (NCBI): 56992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NS87
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15. (14618103)