KIF20B Polyclonal antibody, PBS Only

• 

  WB analysis using 27269-1-AP (same clone as 27269-1-PBS)

  Mouse Brain tissue lysates were subjected to SDS PAGE followed by western blot with 27269-1-AP (KIF20B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27269-1-AP (same clone as 27269-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27269-1-AP (KIF20B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27269-1-AP (same clone as 27269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27269-1-AP (KIF20B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27269-1-AP (same clone as 27269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27269-1-AP (KIF20B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27269-1-AP (same clone as 27269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27269-1-AP (KIF20B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 27269-1-AP (same clone as 27269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 27269-1-AP (KIF20B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27269-1-PBS in a different storage buffer formulation.

KIF20B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27269-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27269-1-PBS targets KIF20B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26191

  Product name: Recombinant human KIF20B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 477-580 aa of NM_001284259

  Sequence: MQKVCVPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLI

• Full Name: kinesin family member 20B
• Calculated Molecular Weight: 211 kDa
• Observed Molecular Weight: 214 kDa
• GenBank Accession Number: NM_001284259
• Gene Symbol: KIF20B
• Gene ID (NCBI): 9585
• RRID: AB_2918121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96Q89
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.