Tested Applications
| Positive WB detected in | HT-29 cells, mouse brain tissue, HepG2 cells, Jurkat cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
27269-1-AP targets KIF20B in WB, IHC, ELISA applications and shows reactivity with human, Mouse samples.
| Tested Reactivity | human, Mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26191 Product name: Recombinant human KIF20B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 477-580 aa of NM_001284259 Sequence: MQKVCVPDTLNSSQEKLFGPVKSSQDVSLDSNSNSKILNVKRATISWENSLEDLMEDEDLVEELENAEETQNVETKLLDEDLDKTLEENKAFISHEEKRKLLDLI Predict reactive species |
| Full Name | kinesin family member 20B |
| Calculated Molecular Weight | 211 kDa |
| Observed Molecular Weight | 214 kDa |
| GenBank Accession Number | NM_001284259 |
| Gene Symbol | KIF20B |
| Gene ID (NCBI) | 9585 |
| RRID | AB_2918121 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96Q89 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for KIF20B antibody 27269-1-AP | Download protocol |
| WB protocol for KIF20B antibody 27269-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell The RNA-stability-independent role of the RNA m6A reader YTHDF2 in promoting protein translation to confer tumor chemotherapy resistance | ||











