KIF21A Polyclonal antibody, PBS Only

• 

  WB analysis using 27276-1-AP (same clone as 27276-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27276-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 27276-1-AP (same clone as 27276-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27276-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 27276-1-AP (same clone as 27276-1-PBS)

  IP result of anti-KIF21A (IP:27276-1-AP, 4ug; Detection:27276-1-AP 1:500) with mouse brain tissue lysate 5600ug. This data was developed using the same antibody clone with 27276-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27276-1-AP (same clone as 27276-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27276-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27276-1-AP (same clone as 27276-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27276-1-PBS in a different storage buffer formulation.

KIF21A Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27276-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

KIF2, KIAA1708, FEOM3A, FEOM1, CFEOM1

---

Product Information

27276-1-PBS targets KIF21A in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26192

  Product name: Recombinant human KIF21A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1230 aa of NM_001173463

  Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL

• Full Name: kinesin family member 21A
• Calculated Molecular Weight: 187 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: NM_001173463
• Gene Symbol: KIF21A
• Gene ID (NCBI): 55605
• RRID: AB_2880825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4S6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)