Tested Applications
Positive WB detected in | HEK-293T cells, mouse brain tissue, MCF-7 |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
27276-1-AP targets KIF21A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26192 Product name: Recombinant human KIF21A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1125-1230 aa of NM_001173463 Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL Predict reactive species |
Full Name | kinesin family member 21A |
Calculated Molecular Weight | 187 kDa |
Observed Molecular Weight | 190-200 kDa |
GenBank Accession Number | NM_001173463 |
Gene Symbol | KIF21A |
Gene ID (NCBI) | 55605 |
RRID | AB_2880825 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7Z4S6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KIF21A antibody 27276-1-AP | Download protocol |
IHC protocol for KIF21A antibody 27276-1-AP | Download protocol |
IP protocol for KIF21A antibody 27276-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |