KIF21A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KIF21A Polyclonal antibody (27276-1-AP)

KIF21A Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 27276-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIF2, KIAA1708, FEOM3A, FEOM1, CFEOM1

• 

  WB analysis using 27276-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 27276-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 27276-1-AP

  IP result of anti-KIF21A (IP:27276-1-AP, 4ug; Detection:27276-1-AP 1:500) with mouse brain tissue lysate 5600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 27276-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 27276-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KIF21A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, mouse brain tissue, MCF-7
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27276-1-AP targets KIF21A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26192

  Product name: Recombinant human KIF21A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1230 aa of NM_001173463

  Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL

• Full Name: kinesin family member 21A
• Calculated Molecular Weight: 187 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: NM_001173463
• Gene Symbol: KIF21A
• Gene ID (NCBI): 55605
• RRID: AB_2880825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4S6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)

Publications

What published studies show

The KIF21A Polyclonal antibody (Cat# 27276-1-AP) has 1 citation. It appears in Neural Regen Res, published in 2023. The cited study investigated the interaction between KIF21A and KANK1 in regulating dendritic morphology and synapse plasticity in neurons, placing it in the neuroscience research field. The antibody was applied in WB and IF using rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IF	Neural Regen Res; The interaction between KIF21A and KANK1 regulates dendritic morphology and synapse plasticity in neurons; Authors - Shi-Yan Sun