KIF21A Polyclonal antibody

• 

  WB analysis using 27276-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 27276-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27276-1-AP (KIF21A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 27276-1-AP

  IP result of anti-KIF21A (IP:27276-1-AP, 4ug; Detection:27276-1-AP 1:500) with mouse brain tissue lysate 5600ug.

• 

  IHC staining of human ovary cancer using 27276-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 27276-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27276-1-AP (KIF21A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KIF21A Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 27276-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIF2, KIAA1708, FEOM3A, FEOM1, CFEOM1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, mouse brain tissue, MCF-7
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

27276-1-AP targets KIF21A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26192

  Product name: Recombinant human KIF21A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1125-1230 aa of NM_001173463

  Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL

• Full Name: kinesin family member 21A
• Calculated Molecular Weight: 187 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: NM_001173463
• Gene Symbol: KIF21A
• Gene ID (NCBI): 55605
• RRID: AB_2880825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4S6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IF	Neural Regen Res; The interaction between KIF21A and KANK1 regulates dendritic morphology and synapse plasticity in neurons; Authors - Shi-Yan Sun