Product Information
27276-1-PBS targets KIF21A in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26192 Product name: Recombinant human KIF21A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1125-1230 aa of NM_001173463 Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL Predict reactive species |
| Full Name | kinesin family member 21A |
| Calculated Molecular Weight | 187 kDa |
| Observed Molecular Weight | 190-200 kDa |
| GenBank Accession Number | NM_001173463 |
| Gene Symbol | KIF21A |
| Gene ID (NCBI) | 55605 |
| RRID | AB_2880825 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z4S6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
KIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)









