KIF23 Polyclonal antibody, PBS Only

• 

  WB analysis using 28587-1-AP (same clone as 28587-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28587-1-AP (KIF23 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28587-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28587-1-AP (same clone as 28587-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28587-1-AP (KIF23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28587-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28587-1-AP (same clone as 28587-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28587-1-AP (KIF23 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 28587-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 28587-1-AP (same clone as 28587-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using KIF23 antibody (28587-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 28587-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KIF23 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28587-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MKLP1, KNSL5

---

Product Information

28587-1-PBS targets KIF23 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29346

  Product name: Recombinant human KIF23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 486-683 aa of NM_138555

  Sequence: LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV

• Full Name: kinesin family member 23
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: NM_138555
• Gene Symbol: KIF23
• Gene ID (NCBI): 9493
• RRID: AB_2881176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02241
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF23, also known as KNSL5 and MKLP1, is a member of the kinesin-like protein family. It plays a crucial role in cytokinesis, the final stage of cell division. It is involved in the formation of the central spindle, which is essential for the proper separation of the cytoplasm and the formation of the cleavage furrow. KIF23 is also involved in the organization and transport of intracellular vesicles and organelles. Mutations in KIF23 have been associated with congenital dyserythropoietic anemia type III(PMID: 23570799).