Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 9 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
21186-1-AP targets KIF5A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15518 Product name: Recombinant human KIF5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species |
| Full Name | kinesin family member 5A |
| Calculated Molecular Weight | 1032 aa, 117 kDa |
| Observed Molecular Weight | 118-120 kDa |
| GenBank Accession Number | BC146670 |
| Gene Symbol | KIF5A |
| Gene ID (NCBI) | 3798 |
| RRID | AB_10733125 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12840 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF5A antibody 21186-1-AP | Download protocol |
| IHC protocol for KIF5A antibody 21186-1-AP | Download protocol |
| IP protocol for KIF5A antibody 21186-1-AP | Download protocol |
| WB protocol for KIF5A antibody 21186-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Neurol Axonal injury mediated by neuronal p75NTR/TRAF6/JNK pathway contributes to cognitive impairment after repetitive mTBI | ||
Hum Mol Genet Mitochondrial transport mediates survival of retinal ganglion cells in affected LHON patients. | ||
Biol Sex Differ Axonal transport in a peripheral diabetic neuropathy model: sex-dimorphic features. | ||
Cell Rep Methods Human MAPT knockin mouse models of frontotemporal dementia for the neurodegenerative research community | ||
Alzheimers Res Ther Normal levels of KIF5 but reduced KLC1 levels in both Alzheimer disease and Alzheimer disease in Down syndrome: evidence suggesting defects in anterograde transport. | ||
JCI Insight Transcriptional control of a collagen deposition and adhesion process that promotes lung adenocarcinoma growth and metastasis.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xuqiao (Verified Customer) (08-25-2020) | It specifically probes both endogenous and transfected KIF5A from either human or mouse.
![]() |














