Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

KIF5A Polyclonal antibody

KIF5A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

NKHC, Neuronal kinesin heavy chain, MY050, Kinesin heavy chain neuron-specific 1, Kinesin heavy chain isoform 5A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for KIF5A in ?

Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21186-1-AP targets KIF5A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15518

Product name: Recombinant human KIF5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 931-1032 aa of BC146670

Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

Predict reactive species
Full Name kinesin family member 5A
Calculated Molecular Weight 1032 aa, 117 kDa
Observed Molecular Weight 118-120 kDa
GenBank Accession NumberBC146670
Gene Symbol KIF5A
Gene ID (NCBI) 3798
RRIDAB_10733125
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12840
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting.

Protocols

Product Specific Protocols
IF protocol for KIF5A antibody 21186-1-APDownload protocol
IHC protocol for KIF5A antibody 21186-1-APDownload protocol
IP protocol for KIF5A antibody 21186-1-APDownload protocol
WB protocol for KIF5A antibody 21186-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The KIF5A Polyclonal antibody (Cat# 21186-1-AP) has 12 citations across journals including Experimental Molecular Medicine, Alzheimer's Research & Therapy, JCI Insight, Neurobiology of Disease, Cell Reports Methods, Biology of Sex Differences, Experimental Neurology, Brain Research Bulletin, FASEB Journal, Frontiers in Oncology, Human Molecular Genetics, and F1000Research. Associated research fields include neurodegeneration (Alzheimer's disease, frontotemporal dementia), axonal transport, epilepsy, diabetic neuropathy, traumatic brain injury, hepatocellular carcinoma, and mitochondrial transport.

SpeciesApplicationTitle
mouseWB,CoIP

Exp Mol Med

Activation of TLR7-mediated autophagy increases epileptic susceptibility via reduced KIF5A-dependent GABAA receptor transport in a murine model

Authors - Jing Liu
  • KD Validated
mouseWB

Alzheimers Res Ther

Normal levels of KIF5 but reduced KLC1 levels in both Alzheimer disease and Alzheimer disease in Down syndrome: evidence suggesting defects in anterograde transport.

Authors - Xu-Qiao Chen
mouseWB

JCI Insight

Transcriptional control of a collagen deposition and adhesion process that promotes lung adenocarcinoma growth and metastasis.

Authors - Xiaochao Tan
  • KD Validated
mouseWB,IF

Neurobiol Dis

Amyloid beta-mediated KIF5A deficiency disrupts anterograde axonal mitochondrial movement.

Authors - Qi Wang
  • KD Validated
mouseIF

Cell Rep Methods

Human MAPT knockin mouse models of frontotemporal dementia for the neurodegenerative research community

Authors - Takahiro Morito
ratWB

Biol Sex Differ

Axonal transport in a peripheral diabetic neuropathy model: sex-dimorphic features.

Authors - Marzia Pesaresi

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is highly positive (5/5). The reviewer used it for Western Blot at a 1:2000 dilution on HEK293T cells and reported that the antibody specifically detects both endogenous and transfected KIF5A in both human and mouse samples, highlighting its strong specificity across species.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xuqiao (Verified Customer) (08-25-2020)

It specifically probes both endogenous and transfected KIF5A from either human or mouse.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T cell
KIF5A Antibody Western Blot validation (1:2000 dilution) in HEK293T cell (Cat no:21186-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...