Product Information
84013-1-PBS targets KIF5A in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag15518 Product name: Recombinant human KIF5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species |
| Full Name | kinesin family member 5A |
| Calculated Molecular Weight | 1032 aa, 117 kDa |
| GenBank Accession Number | BC146670 |
| Gene Symbol | KIF5A |
| Gene ID (NCBI) | 3798 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12840 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

