Tested Applications
Positive WB detected in | HEK-293 cells |
Positive IP detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
24693-1-AP targets KIF7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19119 Product name: Recombinant human KIF7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1214-1332 aa of BC112271 Sequence: VNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGPLSKPRRELRRAS Predict reactive species |
Full Name | kinesin family member 7 |
Calculated Molecular Weight | 1343 aa, 151 kDa |
Observed Molecular Weight | 140 kDa |
GenBank Accession Number | BC112271 |
Gene Symbol | KIF7 |
Gene ID (NCBI) | 374654 |
RRID | AB_2879677 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q2M1P5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF7(Kinesin family member 7) is a microtubule interacting protein that functions to regulate Hh signaling by maintaining the architecture of the primary cilium, a complex microtubule-based organelle with many signal transduction functions (PMID: 26439735). KIF7 has been shown to have both negative and positive roles in Shh signal transduction. Without a ligand, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components and promotes the processing of GliRs (PMID: 21552264).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KIF7 antibody 24693-1-AP | Download protocol |
IP protocol for KIF7 antibody 24693-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Adv Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ. | ||
Cells Determination of WWOX Function in Modulating Cellular Pathways Activated by AP-2α and AP-2γ Transcription Factors in Bladder Cancer. | ||
Thorac Cancer Human papillomavirus 16 (HPV 16) E6 but not E7 inhibits the antitumor activity of LKB1 in lung cancer cells by downregulating the expression of KIF7.
| ||
Cell Death Dis Circular RNA circUBE2J2 acts as the sponge of microRNA-370-5P to suppress hepatocellular carcinoma progression. | ||
Proteome Sci Proteomics identifies differentially expressed proteins in glioblastoma U87 cells treated with hederagenin | ||
Leukemia P4HA2 hydroxylates SUFU to regulate the paracrine Hedgehog signaling and promote B-cell lymphoma progression |