KIF7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86970-1-RR (same clone as 86970-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86970-1-RR (KIF7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86970-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86970-1-RR (same clone as 86970-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86970-1-RR (KIF7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86970-1-PBS in a different storage buffer formulation.

KIF7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86970-1-PBS

Clone No.252078H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

kinesin family member 7, Kinesin like protein KIF7, Kinesin-like protein KIF7, UNQ340, UNQ340/PRO539

---

Product Information

86970-1-PBS targets KIF7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19119

  Product name: Recombinant human KIF7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1214-1332 aa of BC112271

  Sequence: VNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGPLSKPRRELRRAS

• Full Name: kinesin family member 7
• Calculated Molecular Weight: 1343 aa, 151 kDa
• Observed Molecular Weight: 150, 170 kDa
• GenBank Accession Number: BC112271
• Gene Symbol: KIF7
• Gene ID (NCBI): 374654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q2M1P5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF7(Kinesin family member 7) is a microtubule interacting protein that functions to regulate Hh signaling by maintaining the architecture of the primary cilium, a complex microtubule-based organelle with many signal transduction functions (PMID: 26439735). KIF7 has been shown to have both negative and positive roles in Shh signal transduction. Without a ligand, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components and promotes the processing of GliRs (PMID: 21552264).