KIFC3 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse lung using 10125-2-AP (same clone as 10125-2-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10125-2-AP (KIFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10125-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 10125-2-AP (same clone as 10125-2-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10125-2-AP (KIFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10125-2-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 10125-2-AP (same clone as 10125-2-PBS)

  IP result of anti-KIFC3 (IP:10125-2-AP, 4ug; Detection:10125-2-AP 1:500) with mouse kidney tissue lysate 7200ug. This data was developed using the same antibody clone with 10125-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10125-2-AP (same clone as 10125-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10125-2-AP (KIFC3 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10125-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KIFC3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10125-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

10125-2-PBS targets KIFC3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0172

  Product name: Recombinant human KIFC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-314 aa of BC001211

  Sequence: ARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLMVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQI

• Full Name: kinesin family member C3
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 80-85 kDa, 95-100 kDa
• GenBank Accession Number: BC001211
• Gene Symbol: KIFC3
• Gene ID (NCBI): 3801
• RRID: AB_2296476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVG8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.