KIFC3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KIFC3 Polyclonal antibody (10125-2-AP)

• Featured Product
• KD/KO Validated

KIFC3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10125-2-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Kinesin-like protein KIFC3

• 

  WB analysis of mouse lung using 10125-2-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10125-2-AP (KIFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 10125-2-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10125-2-AP (KIFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 10125-2-AP

  IP result of anti-KIFC3 (IP:10125-2-AP, 4ug; Detection:10125-2-AP 1:500) with mouse kidney tissue lysate 7200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10125-2-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10125-2-AP (KIFC3 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KIFC3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10125-2-AP targets KIFC3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0172

  Product name: Recombinant human KIFC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-314 aa of BC001211

  Sequence: ARSAARPALAQCRALSVDWAGPGSPHGLYLTLQVEHLKEKLISQAQEVSRLRSELGGTDLEKHRDLLMVENERLRQEMRRCEAELQELRTKPAGPCPGCEHSQESAQLRDKLSQLQLEMAESKGMLSELNLEVQQKTDRLAEVELRLKDCLAEKAQEEERLSRRLRDSHETIASLRAQSPPVKYVIKTVEVESSKTKQALSESQARNQHLQEQVAMQRQVLKEMEQQLQSSHQLTARLRAQI

• Full Name: kinesin family member C3
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 80-85 kDa, 95-100 kDa
• GenBank Accession Number: BC001211
• Gene Symbol: KIFC3
• Gene ID (NCBI): 3801
• RRID: AB_2296476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVG8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-KIFC3 antibody (Cat# 10125-2-AP) has 10 total citations published across 9 journals, including Nature Communications, EMBO Journal, Cancer Research, Cell Communication and Signaling, Cancer Science, Experimental Cell Research, Molecular Biology of the Cell, World Journal of Gastrointestinal Oncology, and Biochimica et Biophysica Acta. Research fields span hepatocellular carcinoma, esophageal cancer, breast cancer, ciliary biology, oocyte meiosis, endocytic vesicle transport, peroxisome positioning, and metastasis suppression.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; PMID: 19789344; Authors - De Sarmishtha S
human	WB,IF	Nat Commun; Transiently formed nucleus-to-cilium microtubule arrays mediate senescence initiation in a KIFC3-dependent manner; Authors - Jielu Hao Robichaud
mouse	WB,CoIP,IF	Cell Commun Signal; Kinesin KIFC3 is essential for microtubule stability and cytokinesis in oocyte meiosis; Authors - Jia-Qian Ju
human	WB	EMBO J; Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome.; Authors - Tatsuo Miyamoto ; KO Validated
		Cancer Sci; Nucleus-localized circSLC39A5 suppresses hepatocellular carcinoma development by binding to STAT1 to regulate TDG transcription; Authors - Meiliang Liu
human	WB	Exp Cell Res; KIFC3 regulates progression of hepatocellular carcinoma via EMT and the AKT/mTOR pathway; Authors - Shimin Lu ; KD Validated