KL Polyclonal antibody, PBS Only

• 

  WB analysis using 28100-1-AP (same clone as 28100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 28100-1-AP (same clone as 28100-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 28100-1-AP (same clone as 28100-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 28100-1-AP (same clone as 28100-1-PBS)

  IP result of anti-KL (IP:28100-1-AP, 4ug; Detection:28100-1-AP 1:300) with mouse kidney tissue lysate 4000 ug. This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28100-1-AP (same clone as 28100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28100-1-AP (same clone as 28100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28100-1-AP (same clone as 28100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28100-1-AP (same clone as 28100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28100-1-AP (same clone as 28100-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28100-1-PBS in a different storage buffer formulation.

KL Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 28100-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

alpha klotho, klotho, α klotho, α-klotho

---

Product Information

28100-1-PBS targets KL in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27759

  Product name: Recombinant human KL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-184 aa of NM_004795

  Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG

• Full Name: klotho
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 62 kDa, 130 kDa
• GenBank Accession Number: NM_004795
• Gene Symbol: KL
• Gene ID (NCBI): 9365
• RRID: AB_2881060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UEF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.