KL Polyclonal antibody

KL Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 28100-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

alpha klotho, klotho, α klotho, α-klotho

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, rat kidney tissue
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman kidney tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28100-1-AP targets KL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27759

Product name: Recombinant human KL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 34-184 aa of NM_004795

Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG

Predict reactive species
Full Name klotho
Calculated Molecular Weight 116 kDa
Observed Molecular Weight 62 kDa, 130 kDa
GenBank Accession NumberNM_004795
Gene Symbol KL
Gene ID (NCBI) 9365
RRIDAB_2881060
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UEF7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for KL antibody 28100-1-APDownload protocol
IP protocol for KL antibody 28100-1-APDownload protocol
WB protocol for KL antibody 28100-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Oxid Med Cell Longev

Cigarette Smoke Exposure Increases Glucose-6-phosphate Dehydrogenase, Autophagy, Fibrosis, and Senescence in Kidney Cells In Vitro and In Vivo.

Authors - Wen-Chih Liu

Acta Pharmacol Sin

Dihydroartemisinin suppresses renal fibrosis in mice by inhibiting DNA-methyltransferase 1 and increasing Klotho.

Authors - Wei Zhou
mouseWB

Ecotoxicol Environ Saf

Effects of selenium-cadmium co-enriched Cardamine hupingshanensis on bone damage in mice

Authors - Lin Zhang
humanIHC

Cell Mol Life Sci

α-Klotho released from HK-2 cells inhibits osteogenic differentiation of renal interstitial fibroblasts by inactivating the Wnt-β-catenin pathway.

Authors - Zewu Zhu
ratWB

Sci Rep

PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats.

Authors - Jing Li
mouseWB

Hum Cell

Serine protease HtrA2/Omi regulates adaptive mitochondrial reprogramming in the brain cortex after ischemia/reperfusion injury via UCP2-SIRT3-PGC1 axis.

Authors - Hao Meng
Loading...
||
New chat Able
正在加载,请稍候...