KL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KL Polyclonal antibody (28100-1-AP)

KL Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 28100-1-AP Copied!

Publications (39)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

alpha klotho, klotho, α klotho, α-klotho

• 

  WB analysis using 28100-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 28100-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 28100-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 28100-1-AP

  IP result of anti-KL (IP:28100-1-AP, 4ug; Detection:28100-1-AP 1:300) with mouse kidney tissue lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human kidney tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28100-1-AP targets KL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27759

  Product name: Recombinant human KL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-184 aa of NM_004795

  Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG

• Full Name: klotho
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 62 kDa, 130 kDa
• GenBank Accession Number: NM_004795
• Gene Symbol: KL
• Gene ID (NCBI): 9365
• RRID: AB_2881060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UEF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Klotho antibody (Cat# 28100-1-AP) has accumulated 39 citations across journals including Advanced Science, Phytomedicine, Acta Pharmacologica Sinica, Journal of Translational Medicine, Apoptosis, Antioxidants, Stem Cell Research & Therapy, Oxidative Medicine and Cellular Longevity, Cell and Molecular Life Sciences, and International Journal of Molecular Sciences. Associated research fields span renal fibrosis, kidney aging, ferroptosis, diabetic kidney disease, cellular senescence, cardiovascular disease, oxidative stress, liver fibrosis, and placental biology.

Automatically generated from the 39 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); Treatment with Minicircle DNA Expressing a FGF23 Fragment in a Clinically relevant Mouse Model of X-Linked Hypophosphatemic Rickets.; Authors - Huixiao Wu
mouse	WB,IHC	Phytomedicine; Unveiling the protective effects of Cistanche phenylethanol glycosides against D-galactose-induced kidney aging: Insights from network pharmacology and transcriptomics.; Authors - Qianqian Wang
		Acta Pharmacol Sin; Dihydroartemisinin suppresses renal fibrosis in mice by inhibiting DNA-methyltransferase 1 and increasing Klotho.; Authors - Wei Zhou
		J Transl Med; ABI3BP promotes renal aging through Klotho-mediated ferroptosis; Authors - Ren Ji
human	WB	Apoptosis; Vitamin D inhibits ferroptosis and mitigates the kidney injury of prediabetic mice by activating the Klotho/p53 signaling pathway; Authors - Hao Chen
rat	IHC	Antioxidants (Basel); Dynamic Regulation of Ferroptosis in a Neonatal Rat Model of Postnatal Hypoxia-Induced Acute Kidney Injury.; Authors - Tzu-Hao Liu