KL Polyclonal antibody

• 

  WB analysis using 28100-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 28100-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 28100-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 28100-1-AP (KL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 28100-1-AP

  IP result of anti-KL (IP:28100-1-AP, 4ug; Detection:28100-1-AP 1:300) with mouse kidney tissue lysate 4000 ug.

• 

  IHC staining of human kidney using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28100-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28100-1-AP (KL antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KL Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 28100-1-AP

Publications(27)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

alpha klotho, klotho, α klotho, α-klotho

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human kidney tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 21 publications below
• IHC: See 5 publications below
• IF: See 3 publications below

Product Information

28100-1-AP targets KL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27759

  Product name: Recombinant human KL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-184 aa of NM_004795

  Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG

• Full Name: klotho
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 62 kDa, 130 kDa
• GenBank Accession Number: NM_004795
• Gene Symbol: KL
• Gene ID (NCBI): 9365
• RRID: AB_2881060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UEF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oxid Med Cell Longev; Cigarette Smoke Exposure Increases Glucose-6-phosphate Dehydrogenase, Autophagy, Fibrosis, and Senescence in Kidney Cells In Vitro and In Vivo.; Authors - Wen-Chih Liu
		Acta Pharmacol Sin; Dihydroartemisinin suppresses renal fibrosis in mice by inhibiting DNA-methyltransferase 1 and increasing Klotho.; Authors - Wei Zhou
mouse	WB	Ecotoxicol Environ Saf; Effects of selenium-cadmium co-enriched Cardamine hupingshanensis on bone damage in mice; Authors - Lin Zhang
human	IHC	Cell Mol Life Sci; α-Klotho released from HK-2 cells inhibits osteogenic differentiation of renal interstitial fibroblasts by inactivating the Wnt-β-catenin pathway.; Authors - Zewu Zhu
rat	WB	Sci Rep; PET-CT and RNA sequencing reveal novel targets for acupuncture-induced lowering of blood pressure in spontaneously hypertensive rats.; Authors - Jing Li
mouse	WB	Hum Cell; Serine protease HtrA2/Omi regulates adaptive mitochondrial reprogramming in the brain cortex after ischemia/reperfusion injury via UCP2-SIRT3-PGC1 axis.; Authors - Hao Meng