Tested Applications
| Positive WB detected in | K-562 cells, KG-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20935-1-AP targets KLHDC8B in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15028 Product name: Recombinant human KLHDC8B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 70-178 aa of BC039083 Sequence: AGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIY Predict reactive species |
| Full Name | kelch domain containing 8B |
| Calculated Molecular Weight | 354 aa, 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC039083 |
| Gene Symbol | KLHDC8B |
| Gene ID (NCBI) | 200942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IXV7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KLHDC8B antibody 20935-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

