KLHL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KLHL3 Polyclonal antibody (16951-1-AP)

• Featured Product
• KD/KO Validated

KLHL3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16951-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIAA1129, Kelch-like protein 3, Kelch like protein 3

• 

  WB analysis of HepG2 using 16951-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 16951-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 16951-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 16951-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 16951-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 16951-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 16951-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16951-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 16951-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 16951-1-AP

  IP result of anti-KLHL3 (IP:16951-1-AP, 4ug; Detection:16951-1-AP 1:700) with HepG2 cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16951-1-AP (KLHL3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16951-1-AP (KLHL3 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 16951-1-AP (KLHL3 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 16951-1-AP (KLHL3 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLHL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue, Jurkat cells, rat liver tissue, human liver tissue, mouse thymus tissue, HL-60 cells, mouse pancreas tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human tonsillitis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16951-1-AP targets KLHL3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10580

  Product name: Recombinant human KLHL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC034035

  Sequence: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPK

• Full Name: kelch-like 3 (Drosophila)
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC034035
• Gene Symbol: KLHL3
• Gene ID (NCBI): 26249
• RRID: AB_2130861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UH77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-KLHL3 (catalog #16951-1-AP) has 17 citations published in journals including Nature Genetics, Experimental & Molecular Medicine, Cell Death & Differentiation, Journal of the American Society of Nephrology, Human Molecular Genetics, and Molecular and Cellular Biology. Research fields span familial hyperkalemic hypertension, WNK signaling, CUL3–KLHL3 complex biology, COP9 signalosome function, obesity and NAFLD, vascular tone regulation, cardiac disease, and selective autophagy.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nat Genet; KLHL3 mutations cause familial hyperkalemic hypertension by impairing ion transport in the distal nephron.; Authors - Louis-Dit-Picard Hélène H
human,mouse	WB,IP	Exp Mol Med; KLHL3 deficiency in mice ameliorates obesity, insulin resistance, and nonalcoholic fatty liver disease by regulating energy expenditure; Authors - Ju-Hong Jang
human	WB,IHC	Cell Death Differ; A viral interferon regulatory factor degrades RNA-binding protein hnRNP Q1 to enhance aerobic glycolysis via recruiting E3 ubiquitin ligase KLHL3 and decaying GDPD1 mRNA.; Authors - Xiaoyu Qi
		Cell Commun Signal; Insights into the diverse mechanisms and effects of variant CUL3-induced familial hyperkalemic hypertension; Authors - Prashant Sharma
mouse	WB,IF	J Am Soc Nephrol; Combined Kelch-Like 3 and Cullin 3 Degradation is a Central Mechanism in Familial Hyperkalemic Hypertension in Mice.; Authors - Yujiro Maeoka
mouse	WB	J Am Soc Nephrol; Renal COP9 Signalosome Deficiency Alters CUL3-KLHL3-WNK Signaling Pathway.; Authors - Ryan J Cornelius