KLHL3 Polyclonal antibody

• 

  WB analysis of HepG2 using 16951-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 16951-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16951-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16951-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 16951-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 16951-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 16951-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16951-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 16951-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16951-1-AP (KLHL3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 16951-1-AP

  IP result of anti-KLHL3 (IP:16951-1-AP, 4ug; Detection:16951-1-AP 1:700) with HepG2 cells lysate 2800ug.

• 

  IHC staining of human liver using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16951-1-AP (KLHL3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16951-1-AP (KLHL3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16951-1-AP (KLHL3 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 16951-1-AP (KLHL3 Antibody) at dilution of 1:50.

• 

  IHC staining of human tonsillitis using 16951-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis slide using 16951-1-AP (KLHL3 Antibody) at dilution of 1:50.

• Featured Product
• KD/KO Validated

KLHL3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16951-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIAA1129, Kelch-like protein 3, Kelch like protein 3

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue, Jurkat cells, rat liver tissue, human liver tissue, mouse thymus tissue, HL-60 cells, mouse pancreas tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human tonsillitis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 13 publications below
• IHC: See 2 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

16951-1-AP targets KLHL3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10580

  Product name: Recombinant human KLHL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC034035

  Sequence: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPK

• Full Name: kelch-like 3 (Drosophila)
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC034035
• Gene Symbol: KLHL3
• Gene ID (NCBI): 26249
• RRID: AB_2130861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UH77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nat Genet; KLHL3 mutations cause familial hyperkalemic hypertension by impairing ion transport in the distal nephron.; Authors - Louis-Dit-Picard Hélène H
human	WB,IHC	Cell Death Differ; A viral interferon regulatory factor degrades RNA-binding protein hnRNP Q1 to enhance aerobic glycolysis via recruiting E3 ubiquitin ligase KLHL3 and decaying GDPD1 mRNA.; Authors - Xiaoyu Qi
mouse	WB,IF	J Am Soc Nephrol; Combined Kelch-Like 3 and Cullin 3 Degradation is a Central Mechanism in Familial Hyperkalemic Hypertension in Mice.; Authors - Yujiro Maeoka
mouse	WB	J Am Soc Nephrol; Kelch-Like Protein 2 Mediates Angiotensin II-With No Lysine 3 Signaling in the Regulation of Vascular Tonus.; Authors - Moko Zeniya
mouse	WB	J Am Soc Nephrol; Renal COP9 Signalosome Deficiency Alters CUL3-KLHL3-WNK Signaling Pathway.; Authors - Ryan J Cornelius
mouse	IF	Hum Mol Genet; Impaired degradation of WNK1 and WNK4 kinases causes PHAII in mutant KLHL3 knock-in mice.; Authors - Koichiro Susa