KLHL35 Polyclonal antibody

• 

  WB analysis using 21199-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21199-1-AP (KLHL35 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 21199-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 21199-1-AP (KLHL35 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 21199-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 21199-1-AP (KLHL35 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of mouse heart using 21199-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 21199-1-AP (KLHL35 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 21199-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 21199-1-AP (KLHL35 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 21199-1-AP

  Immunofluorescent analysis of Hela cells, using KLHL35 antibody 21199-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

KLHL35 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 21199-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

26597, kelch like 35 (Drosophila), Kelch like protein 35, KLHL35

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue
• Positive IHC detected in: human heart tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21199-1-AP targets KLHL35 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15558

  Product name: Recombinant human KLHL35 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 230-363 aa of BC042952

  Sequence: RQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR

• Full Name: kelch-like 35 (Drosophila)
• Calculated Molecular Weight: 363 aa, 40 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC042952
• Gene Symbol: KLHL35
• Gene ID (NCBI): 283212
• RRID: AB_10693685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PF15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.