Tested Applications
Positive WB detected in | SMMC-7721 cells |
Positive IHC detected in | human liver cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27515-1-AP targets KLK15 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26232 Product name: Recombinant human KLK15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-188 aa of BC069480 Sequence: LRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLT Predict reactive species |
Full Name | kallikrein-related peptidase 15 |
Calculated Molecular Weight | 255 aa, 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC069480 |
Gene Symbol | KLK15 |
Gene ID (NCBI) | 55554 |
RRID | AB_2880895 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H2R5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KLK15 antibody 27515-1-AP | Download protocol |
IHC protocol for KLK15 antibody 27515-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |