KLK15 Polyclonal antibody, PBS Only

• 

  WB analysis of SMMC-7721 using 27515-1-AP (same clone as 27515-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 27515-1-AP (KLK15 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 27515-1-AP (same clone as 27515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27515-1-AP (KLK15 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 27515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 27515-1-AP (same clone as 27515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27515-1-AP (KLK15 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 27515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27515-1-AP (same clone as 27515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27515-1-AP (KLK15 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 27515-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27515-1-AP (same clone as 27515-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27515-1-AP (KLK15 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 27515-1-PBS in a different storage buffer formulation.

KLK15 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27515-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27515-1-PBS targets KLK15 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26232

  Product name: Recombinant human KLK15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 109-188 aa of BC069480

  Sequence: LRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLT

• Full Name: kallikrein-related peptidase 15
• Calculated Molecular Weight: 255 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC069480
• Gene Symbol: KLK15
• Gene ID (NCBI): 55554
• RRID: AB_2880895
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2R5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.