KLRG1 Polyclonal antibody

• 

  WB analysis using 10974-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human peripheral blood leukocyte using 10974-1-AP

  Human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 10974-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 10974-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10974-1-AP (KLRG1 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 10974-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10974-1-AP (KLRG1 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KLRG1 Polyclonal Antibody for WB, ELISA

Cat No. 10974-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

MAFA 2F1, MAFA, Killer cell lectin-like receptor subfamily G member 1, ITIM-containing receptor MAFA-L, C-type lectin domain family 15 member A

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, human peripheral blood leukocyte, NK-92 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

10974-1-AP targets KLRG1 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1407

  Product name: Recombinant human KLRG1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-195 aa of BC012621

  Sequence: MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

• Full Name: killer cell lectin-like receptor subfamily G, member 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC012621
• Gene Symbol: KLRG1
• Gene ID (NCBI): 10219
• RRID: AB_2234383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96E93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLRG1 (killer cell lectin-like receptor subfamily G, member 1) is a C-type lectin inhibitory receptor that contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain. KLRG1 is expressed by subsets of NK and T cells, existing both as a monomer and as a disulfide-linked homodimer (PMID: 10741410; 19604491). It is considered to be a cell differentiation marker for NK and T cells and is strongly induced by viral and other infections (PMID: 20373518). Through interactions with members of the cadherin family, KLRG1 plays an inhibitory role in NK- and T-cell function (PMID: 19009530; 20373518). Because of the glycosylation and disulfide bonds of the KLRG1 proteins, the observed molecular weights are typically 30-38 kDa (PMID: 17404256).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Brain; Highly differentiated cytotoxic T cells in inclusion body myositis.; Authors - Steven A Greenberg
human	IF	J Neurol; Morphological and molecular comparison of HIV-associated and sporadic inclusion body myositis; Authors - Sinja Vogt