KMT2C Polyclonal antibody

• 

  WB analysis using 28437-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 28437-1-AP (KMT2C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 28437-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28437-1-AP (KMT2C antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 28437-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28437-1-AP (KMT2C antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KMT2C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28437-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, CoIP, ChIP, ELISA

Synonyms

MLL3, Lysine N methyltransferase 2C, KIAA1506, Homologous to ALR protein, HALR

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below
• ChIP: See 1 publications below

Product Information

28437-1-AP targets KMT2C in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28875

  Product name: Recombinant human KMT2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2771-3000 aa of NM_170606

  Sequence: SMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEKRTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPPPTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV

• Full Name: myeloid/lymphoid or mixed-lineage leukemia 3
• Calculated Molecular Weight: 541 kDa
• Observed Molecular Weight: 541kDa, 269 kDa
• GenBank Accession Number: NM_170606
• Gene Symbol: KMT2C
• Gene ID (NCBI): 58508
• RRID: AB_2918165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEZ4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lysine (K)-specific methyltransferase 2C (KMT2C, also known as MLL3) belongs to the mixed-lineage leukemia (MLL) family of histone methyltransferases which methylate the histone 3 tail at lysine 4 (H3K4) as part of the complex proteins associated with Set 1 (COMPASS) complex. Although originally identified as oncogenic fusions in leukemia, genome-wide mutation studies have revealed frequent, presumably loss-of-function, mutations in various members of the MLL family, including MLL2/KMT2B, MLL3/KMT2C, and MLL4/KMT2D in a variety of malignancies, particularly solid tumors. Mechanistic studies of KMT2C in normal cells have focused primarily on its role in enhancer regulation by deposition of H3K4me1 marks.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int Immunopharmacol; Polysaccharides from Platycodonis Radix ameliorated respiratory syncytial virus-induced epithelial cell apoptosis and inflammation through activation of miR-181a-mediated Hippo and SIRT1 pathways.; Authors - Juan-Juan Li
human	ChIP	J Biol Chem; TRIM28 represses renal cell carcinoma cell proliferation by inhibiting TFE3/KDM6A-regulated autophagy; Authors - Tanjing Song
human	WB,IF,CoIP	Adv Sci (Weinh); TAOK3 Facilitates Esophageal Squamous Cell Carcinoma Progression and Cisplatin Resistance Through Augmenting Autophagy Mediated by IRGM; Authors - Mingchuang Sun
human	WB	Nat Chem Biol; UFL1 triggers replication fork degradation by MRE11 in BRCA1/2-deficient cells; Authors - Tian Tian
Human		BMC Med Genomics; Clinical characteristics and genetic analysis of four pediatric patients with Kleefstra syndrome; Authors - Rong Ren