Tested Applications
Positive WB detected in | HEK-293 cells |
Positive IHC detected in | human breast cancer tissue, human lymphoma tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 4 publications below |
IHC | See 6 publications below |
IF | See 3 publications below |
ChIP | See 3 publications below |
Product Information
27266-1-AP targets KMT2D in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26195 Product name: Recombinant human KMT2D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4821-4920 aa of NM_003482 Sequence: MESPARAGTEPKKGEAEGPGGKEKGLEGKSPDTGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSP Predict reactive species |
Full Name | myeloid/lymphoid or mixed-lineage leukemia 2 |
Calculated Molecular Weight | 593 kDa |
Observed Molecular Weight | 593 kDa |
GenBank Accession Number | NM_003482 |
Gene Symbol | KMT2D/MLL2 |
Gene ID (NCBI) | 8085 |
RRID | AB_2880823 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14686 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KMT2D (a COMPASS/ Set1 family member; also known as MLL4, ALR, and MLL2) is the biggest H3K4 methyltransferase among the most frequently mutated genes in many different types of cancer (PMID: 34194626). The enzymatic function of KMT2D depends on a cluster of C-terminal conserved domains, including a PHD domain, two FY-rich motifs (FYRC and FYRN) and a catalytic SET domain. KMT2D has two frequently occurring genomic alterations: truncation and missense mutations. Loss of KMT2D is a bona fide tumor suppressor gene in FL and DLBCL. Kmt2d perturbed the expression of genes that sustain proliferation and survival, and the KMT2D protein directly binds and associates with an active chromatin conformation in negative modulators of the BCR and lymphocyte migration pathways, which in turn could affect B cell responses to antigen(PMID: 26366712).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for KMT2D antibody 27266-1-AP | Download protocol |
IHC protocol for KMT2D antibody 27266-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Immunol Res Molecular Subgroups of Intrahepatic Cholangiocarcinoma Discovered by Single-Cell RNA Sequencing-Assisted Multiomics Analysis. | ||
Oncogene Histone 3 lysine-27 demethylase KDM6A coordinates with KMT2B to play an oncogenic role in NSCLC by regulating H3K4me3. | ||
Cell Biosci Histone methyltransferase KMT2D cooperates with MEF2A to promote the stem-like properties of oral squamous cell carcinoma. | ||
Thorac Cancer RNF213 gene mutation in circulating tumor DNA detected by targeted next-generation sequencing in the assisted discrimination of early-stage lung cancer from pulmonary nodules. | ||
Transl Cancer Res Histone methyltransferase KMT2D mediated lipid metabolism via peroxisome proliferator-activated receptor gamma in prostate cancer | ||
Cell Death Discov Pseudogene ACTBP2 increases blood-brain barrier permeability by promoting KHDRBS2 transcription through recruitment of KMT2D/WDR5 in Aβ1-42 microenvironment. |