KPNA3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86722-1-RR (same clone as 86722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86722-1-RR (KPNA3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86722-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86722-1-RR (same clone as 86722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86722-1-RR (KPNA3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86722-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86722-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86722-1-RR against Human KPNA3 were performed. The affinity constant is 6.85 nM.

KPNA3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86722-1-PBS

Clone No.251681E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Importin alpha Q2, Importin subunit alpha-4, Karyopherin subunit alpha 3, Karyopherin subunit alpha-3, Qip2

---

Product Information

86722-1-PBS targets KPNA3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27755

  Product name: Recombinant human KPNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 322-453 aa of BC017355

  Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII

• Full Name: karyopherin alpha 3 (importin alpha 4)
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 57-60 kDa
• GenBank Accession Number: BC017355
• Gene Symbol: KPNA3
• Gene ID (NCBI): 3839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00505
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin.